PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G68210.1
Common NameAPRR6, PRR6, T22E19.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 755aa    MW: 86181.8 Da    PI: 4.4677
Description pseudo-response regulator 6
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G68210.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like47.73.4e-15224275355
      G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +  W++e H +F+ a++ L G+e   Pk+ile+m+ + Lt  +v SHLQkY+ 
  AT1G68210.1 224 KSLWNSERHMKFIAAISIL-GEEDFRPKSILEIMNDPNLTHRQVGSHLQKYKA 275
                  567****************.9999***************************85 PP

2Response_reg24.71.1e-09151221109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   +l++d + +    l+++l++    +v ++d +++al ++++++  ++li+  iemp++d + +l  +  ++  +p i++  + + +   + l   a 
   AT1G68210.1  15 ILLIDHDTASIASLTSMLQQFSK-RVMSVDVASKALSMIEKQKkeIGLIIANIEMPHIDSHSFLNALLLKD--IPLILINPEIKTKEPSDLLTKRAC 108
                   79999999***********7777.888888888888888666666**********************8866..999999999998988899988888 PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                     l Kp++ +++ +
   AT1G68210.1 109 FSLDKPISNDDIKN 122
                   88888888888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.55E-1112156IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.2E-1412144No hitNo description
PROSITE profilePS5011022.96114128IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.9E-715123IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.06E-616128No hitNo description
SuperFamilySSF466892.51E-11222277IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-16223279IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-13224274IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MAGCLVPECA DDISILLIDH DTASIASLTS MLQQFSKRVM SVDVASKALS MIEKQKKEIG  60
LIIANIEMPH IDSHSFLNAL LLKDIPLILI NPEIKTKEPS DLLTKRACFS LDKPISNDDI  120
KNMWQHVFSK KSQELKKINI TEDQENVMDK DTYQIEAFRA NLKRQRISQA SLLGRRPFID  180
TFSTYETFQK RKSIANVEWK TTPSYAIEIE NKRKEWKKSV GRRKSLWNSE RHMKFIAAIS  240
ILGEEDFRPK SILEIMNDPN LTHRQVGSHL QKYKAQIDQI SYTLPRNESR SIDKTFEYPS  300
NYKYPFKISD LTNNLIVSNS LWNSLEKKNS ASASITQFLF KKPIGEKEET MPKFHIGGKL  360
DLSNHSVHGN VLNKLSMNVN FVPSTISNNP AYNILSIDSS SIDSSSYTGL VSTGLSSENS  420
PILYGLPSND GASNTCTSQM ESERISIPQY DPNQCHPHRS ILETDVNQID LDFTSILDSF  480
DPLVDECLMK ENNRFLPNPT MNLLDTDIDK MDWVSFIENL SHHDINMNHM DWDPSTANYV  540
LPETNMNINF PEKHTNEIGW VSSQVGYVPF ENMIPSEVDI NHMGMGYSGG SIPPQEETNT  600
NNVGFVSCEI HSEIPPKTNM AILETNYSNP LDWVFPEDIT SLETNTIQKS LVSCETSYDA  660
LDNMVPLETN MEEMNDALYD ISIEDLISFD IDANEKDIFS WLEDNGFSEE NNMMESCEYH  720
NIESVNQSDD MKIDDNFDDY RECMDWINEE MNKDV
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402543340.0
Expression AtlasAT1G68210-
AtGenExpressAT1G68210-
Functional Description ? help Back to Top
Source Description
TAIRSimilar to ARR response regulator proteins that function in two-component signal transduction but lacking a conserved D-D-K motif in the receiver domain
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G68210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G68210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0164470.0AC016447.5 Arabidopsis thaliana chromosome 1 BAC T22E19 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176988.40.0pseudo-response regulator 6
SwissprotQ9C9F60.0APRR6_ARATH; Putative two-component response regulator-like APRR6
TrEMBLR0I9140.0R0I914_9BRAS; Uncharacterized protein (Fragment)
STRINGAT1G68210.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136851424
Publications ? help Back to Top
  1. Makino S, et al.
    Genes encoding pseudo-response regulators: insight into His-to-Asp phosphorelay and circadian rhythm in Arabidopsis thaliana.
    Plant Cell Physiol., 2000. 41(6): p. 791-803
    [PMID:10945350]
  2. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  3. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  4. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]